Gtpbp1, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Gtpbp1, Each

Details:

This gene is upregulated by interferon-gamma and encodes a protein that is a member of the agp11/gtpbp1 family of gtp-binding proteins. A structurally similar protein has been found in mouse, where disruption of the gene for that protein had no observable phenotype. [Provided by refseqsequence: lmvgsnagivgmtkehlglalalnvpvfvvvtkidmcpanilqetlkllqrllkspgcrkipvlvqskddvivtasnfssermcpifqisnvtgenldllkmflnllsprtsyreeepaefqiddtysvpgvgtvvsgttl