Web Analytics
518-831-8000 sales@utechproducts.com

GTPBP10, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant GTPBP10, Each

1,757.70

Details:

Small G proteins, such as GTPBP10, act as molecular switches that play crucial roles in the regulation of fundamental cellular processes such as protein synthesis, nuclear transport, membrane trafficking, and signal transduction (Hirano et al., 2006 [PubMed 17054726]).[supplied by OMIMSequence: ALKGSKGKDCEIPVPVGISVTDENGKIIGELNKENDRILVAQGGLGGKLLTNFLPLKGQKRIIHLDLKLIADVGLVGFPNAGKSSLLSCVSHAKPAIADYAF

Additional Information

SKU 10287560
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21354