Web Analytics
518-831-8000 sales@utechproducts.com

Hint3, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Hint3, Each

1,757.70

Details:

Histidine triad proteins, such as HINT3, are nucleotide hydrolases and transferases that act on the alpha-phosphate of ribonucleotides (Brenner, 2002 [PubMed 12119013]).[supplied by OMIMSequence: MAEEQVNRSAGLAPDCEASATAETTVSSVGTCEAAAKSPEPKDYDSTCVFCRIAGRQDPGTELLHCENEDLICFKDIKPAATHHYLVVP

Additional Information

SKU 10288210
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22086