Hint3, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Hint3, Each
$ 1,757.70
|
|
Details:
Histidine triad proteins, such as hint3, are nucleotide hydrolases and transferases that act on the alpha-phosphate of ribonucleotides (brenner, 2002 [pubmed 12119013]).[Supplied by omimsequence: maeeqvnrsaglapdceasataettvssvgtceaaakspepkdydstcvfcriagrqdpgtellhcenedlicfkdikpaathhylvvp
Additional Information
| SKU | 10288210 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB22086 |
Loading Cart Data 