Web Analytics
518-831-8000 sales@utechproducts.com

HM13, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant HM13, Each

1,757.70

Details:

The protein encoded by this gene, which localizes to the endoplasmic reticulum, catalyzes intramembrane proteolysis of some signal peptides after they have been cleaved from a preprotein. This activity is required to generate signal sequence-derived human lymphocyte antigen-E epitopes that are recognized by the immune system, and to process hepatitis C virus core protein. The encoded protein is an integral membrane protein with sequence motifs characteristic of the presenilin-type aspartic proteases. Multiple transcript variants encoding several different isoforms have been found for this gene. [provided by RefSeqSequence: PASFPNRQYQLLFTQGSGENKEEIINYEFDTKDLVCLGLSSIVGVWYLLRKHWIANNLFGLAFSLNGVELLHLNNVSTGC

Additional Information

SKU 10290066
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB24385