Hm13, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Hm13, Each
|
|
Details
The protein encoded by this gene, which localizes to the endoplasmic reticulum, catalyzes intramembrane proteolysis of some signal peptides after they have been cleaved from a preprotein. This activity is required to generate signal sequence-derived human lymphocyte antigen-e epitopes that are recognized by the immune system, and to process hepatitis c virus core protein. The encoded protein is an integral membrane protein with sequence motifs characteristic of the presenilin-type aspartic proteases. Multiple transcript variants encoding several different isoforms have been found for this gene. [Provided by refseqsequence: pasfpnrqyqllftqgsgenkeeiinyefdtkdlvclglssivgvwyllrkhwiannlfglafslngvellhlnnvstgc
Additional Information
| SKU | 10290066 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB24385 |
