Hmox2 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Hmox2, Each
$ 1,757.70
|
|
Details:
Heme oxygenase, an essential enzyme in heme catabolism, cleaves heme to form biliverdin, which is subsequently converted to bilirubin by biliverdin reductase, and carbon monoxide, a putative neurotransmitter. Heme oxygenase activity is induced by its substrate heme and by various nonheme substances. Heme oxygenase occurs as 2 isozymes, an inducible heme oxygenase-1 and a constitutive heme oxygenase-2. Hmox1 and hmox2 belong to the heme oxygenase family. Alternative splice variants encoding the same protein have been identified at this locus. [Provided by refseqsequence: mernkdhpafaplyfpmelhrkealtkdmeyffgenweeqvqcpkaaqkyverihyigqnepel
Additional Information
| SKU | 10291920 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB27876 |
