Web Analytics
518-831-8000 sales@utechproducts.com

HS6ST2, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant HS6ST2, Each

1,318.98

Details:

Heparan sulfate proteoglycans are ubiquitous components of the cell surface, extracellular matrix, and basement membranes, and interact with various ligands to influence cell growth, differentiation, adhesion, and migration. This gene encodes a member of the heparan sulfate (HS) sulfotransferase gene family, which catalyze the transfer of sulfate to HS. Different family members and isoforms are thought to synthesize heparan sulfates with tissue-specific structures and functions. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeqSequence: RKRQEQRKFLKGRLLQTHFQSQGQGQSQNPNQNQSQNPNPNANQNLTQNLMQNLTQSLSQKENRESPKQNSGKEQNDNTSNGTND

Additional Information

SKU 10288671
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22628