Hspa12b Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Hspa12b, Each

Details:

The protein encoded by this gene contains an atypical heat shock protein 70 (hsp70) atpase domain and is therefore a distant member of the mammalian hsp70 family. This gene may be involved in susceptibility to atherosclerosis. [Provided by refseqsequence: lavpemglqglyigssperspvpsppgsprtqescgiapltpsqspkpevrapqqasfsvvvaidfgttssgyafsfasdpeaihmmrkwegg