Ifi16 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Ifi16, Each
$ 1,757.70
|
|
Details:
This gene encodes a member of the hin-200 (hematopoietic interferon-inducible nuclear antigens with 200 amino acid repeats) family of cytokines. The encoded protein contains domains involved in dna binding, transcriptional regulation, and protein-protein interactions. The protein localizes to the nucleoplasm and nucleoli, and interacts with p53 and retinoblastoma-1. It modulates p53 function, and inhibits cell growth in the ras/raf signaling pathway. [Provided by refseqsequence: kekftpkkiiaianyvcrngflevypftlvadvnadrnmeipkglirsasvtpkinqlcsqtkgsfvngvfevhkknvrgeftyyeiqdntgkmevvvhgrlttinceegdklkltcfelapksgntgelrsvihshikvik
Additional Information
| SKU | 10292422 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB28576 |
