Ift80 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Ift80, Each

Details:

The ift80 gene encodes a protein with 7 wd40 domains that is a component of the intraflagellar transport (ift) complex b (beales et al., 2007 [Pubmed 17468754]). The ift is essential for the development and maintenance of motile and sensory cilia.[Supplied by omimsequence: eelyscsddhqivkwnlltsettqivklpddiypidfhwfpkslgvkkqtqaesfvltssdgkfhlisklgrveksveahcgavlagrwny