Web Analytics
518-831-8000 sales@utechproducts.com

IFT80 Rabbit anti-Human, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant IFT80, Each

1,757.70

Details:

The IFT80 gene encodes a protein with 7 WD40 domains that is a component of the intraflagellar transport (IFT) complex B (Beales et al., 2007 [PubMed 17468754]). The IFT is essential for the development and maintenance of motile and sensory cilia.[supplied by OMIMSequence: EELYSCSDDHQIVKWNLLTSETTQIVKLPDDIYPIDFHWFPKSLGVKKQTQAESFVLTSSDGKFHLISKLGRVEKSVEAHCGAVLAGRWNY

Additional Information

SKU 10291898
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB27850