Web Analytics
518-831-8000 sales@utechproducts.com

IL1RAPL2, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant IL1RAPL2, Each

1,757.70

Details:

The protein encoded by this gene is a member of the interleukin 1 receptor family. This protein is similar to the interleukin 1 accessory proteins, and is most closely related to interleukin 1 receptor accessory protein-like 1 (IL1RAPL1). This gene and IL1RAPL1 are located at a region on chromosome X that is associated with X-linked nonsyndromic mental retardation. [provided by RefSeqSequence: TTELKVTALLTDKPPKPLFPMENQPSVIDVQLGKPLNIPCKAFFGFSGESGPMIYWMKGEKFIEELAGHIREGEIRLL

Additional Information

SKU 10288939
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22951