Il1rl1 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Il1rl1, Each
|
|
Details
The protein encoded by this gene is a member of the interleukin 1 receptor family. Studies of the similar gene in mouse suggested that this receptor can be induced by proinflammatory stimuli, and may be involved in the function of helper t cells. This gene, interleukin 1 receptor, type i (il1r1), interleukin 1 receptor, type ii (il1r2) and interleukin 1 receptor-like 2 (il1rl2) form a cytokine receptor gene cluster in a region mapped to chromosome 2q12. Alternative splicing of this gene results in multiple transcript variants. [Provided by refseqsequence: pdvlenkcgytlciygrdmlpgedvvtavetnirksrrhifiltpqithnkefayeqevalhcaliqndakviliemealseldmlqaealqdslqhlmkvqgtikwredhiankrslnskfwkhvryqmpvpskiprkassltpl
Additional Information
| SKU | 10286714 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB20378 |
