Il1rn, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Il1rn, Each
|
|
Details:
The protein encoded by this gene is a member of the interleukin 1 cytokine family. This protein inhibits the activities of interleukin 1, alpha (il1a) and interleukin 1, beta (il1b), and modulates a variety of interleukin 1 related immune and inflammatory responses. This gene and five other closely related cytokine genes form a gene cluster spanning approximately 400kb on chromosome 2. A polymorphism of this gene is reported to be associated with increased risk of osteoporotic fractures and gastric cancer. Four alternatively spliced transcript variants encoding distinct isoforms have been reported. [Provided by refseqsequence: eticrpsgrksskmqafriwdvnqktfylrnnqlvagylqgpnvnleekidvvpiephalflgihggkmclscvksgdetrlqleavnitdlsenrkqdkrfafirsdsgpttsfesaacpgwflctameadqpvsltnmpdegvmvtkf
Additional Information
| SKU | 10292323 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB28441 |
