Web Analytics
518-831-8000 sales@utechproducts.com

IL22RA2, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant IL22RA2, Each

1,757.70

Details:

The protein encoded by this gene is a soluble class II cytokine receptor. This protein has been shown to specifically bind to interleukin 22 (IL22), block the interaction of IL22 with its cell surface receptor, and thus inhibit IL22 activity. This protein functions as an IL22 antagonist, and may be important in the regulation of inflammatory response. Three alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeqSequence: PNLPYRYQKEKNVSIEDYYELLYRVFIINNSLEKEQKVYEGAHRAVEIEALTPHSSYCVVAEIYQPMLDRRSQRSEERCVEIP

Additional Information

SKU 10288525
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22465