Web Analytics
518-831-8000 sales@utechproducts.com

INSC, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant INSC, Each

1,757.70

Details:

In Drosophila, neuroblasts divide asymmetrically into another neuroblast at the apical side and a smaller ganglion mother cell on the basal side. Cell polarization is precisely regulated by 2 apically localized multiprotein signaling complexes that are tethered by Inscuteable, which regulates their apical localization (Izaki et al., 2006 [PubMed 16458856]).[supplied by OMIMSequence: CLQVENEHVLKSMKACVSETLSMLGQHFGQLLELALTREVQALVRKIDASDNIYTTESTTGNLFSLTQEGAPLCRIIAKEGGVVALFKVCRQDSFRCLY

Additional Information

SKU 10289368
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23449