Insc, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Insc, Each
$ 1,757.70
|
|
Details:
In drosophila, neuroblasts divide asymmetrically into another neuroblast at the apical side and a smaller ganglion mother cell on the basal side. Cell polarization is precisely regulated by 2 apically localized multiprotein signaling complexes that are tethered by inscuteable, which regulates their apical localization (izaki et al., 2006 [Pubmed 16458856]).[Supplied by omimsequence: clqvenehvlksmkacvsetlsmlgqhfgqllelaltrevqalvrkidasdniyttesttgnlfsltqegaplcriiakeggvvalfkvcrqdsfrcly
Additional Information
| SKU | 10289368 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB23449 |
