Insc, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Insc, Each

Details:

In drosophila, neuroblasts divide asymmetrically into another neuroblast at the apical side and a smaller ganglion mother cell on the basal side. Cell polarization is precisely regulated by 2 apically localized multiprotein signaling complexes that are tethered by inscuteable, which regulates their apical localization (izaki et al., 2006 [Pubmed 16458856]).[Supplied by omimsequence: clqvenehvlksmkacvsetlsmlgqhfgqllelaltrevqalvrkidasdniyttesttgnlfsltqegaplcriiakeggvvalfkvcrqdsfrcly