Web Analytics
518-831-8000 sales@utechproducts.com

INSL5, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant INSL5, Each

1,757.70

Details:

The protein encoded by this gene contains a classical signature of the insulin superfamily and is highly similar to relaxin 3 (RLN3/INSL7). [provided by RefSeqSequence: LEYIRTVIYICASSRWRRHLEGIPQAQQAETGNSFQLPHKREFSEENPAQNLPKVDASGEDRLWGGQMPTEELWKSKKHSVMSR

Additional Information

SKU 10288456
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22388