Web Analytics
518-831-8000 sales@utechproducts.com

Ints1, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Ints1, Each

1,757.70

Details:

Ints1 is a subunit of the integrator complex, which associates with the c-terminal domain of rna polymerase ii large subunit (polr2a; mim 180660) and mediates 3-prime end processing of small nuclear rnas u1 (rnu1; mim 180680) and u2 (rnu2; mim 180690) (baillat et al., 2005 [Pubmed 16239144]).[Supplied by omimsequence: lteeedsqtelliaeeklspeqegqlmpryeelaesveeyvldmlrdqlnrrqpidnvsrnllrlltstcgykevrllavqklemwlqnpk

Additional Information

SKU 10287639
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21441