Web Analytics
518-831-8000 sales@utechproducts.com

INTS10, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant INTS10, Each

1,757.70

Details:

INTS10 is a subunit of the Integrator complex, which associates with the C-terminal domain of RNA polymerase II large subunit (POLR2A; MIM 180660) and mediates 3-prime end processing of small nuclear RNAs U1 (RNU1; MIM 180680) and U2 (RNU2; MIM 180690) (Baillat et al., 2005 [PubMed 16239144]).[supplied by OMIMSequence: KGRRSYGDILHRMKDLCRYMNNFDSEAHAKYKNQVVYSTMLVFFKNAFQYVNSIQPSLFQGPNAPSQVPLVLLEDVSNVYGD

Additional Information

SKU 10289426
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23514