Ints6 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Ints6, Each
$ 1,757.70
|
|
Details:
Dead box proteins, characterized by the conserved motif asp-glu-ala-asp (dead), are putative rna helicases. The protein encoded by this gene is a dead box protein that is part of a complex that interacts with the c-terminus of rna polymerase ii and is involved in 3' end processing of snrnas. In addition, this gene is a candidate tumor suppressor and located in the critical region of loss of heterozygosity (loh). Three transcript variants encoding two different isoforms have been found for this gene. [Provided by refseqsequence: kyelepspltqfilerkspqtcwqvyvsnsakyselghpfgylkastalncvnlfvmpynypvllpllddlfkvhkakptlkwrqsfesylktmppyylgplkkavrmmgapnliadsmeyglsysvisylkklsqqakies
Additional Information
| SKU | 10292275 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB28389 |
