Itpka Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Itpka, Each

Details:

Regulates inositol phosphate metabolism by phosphorylation of second messenger inositol 1,4,5-trisphosphate to ins(1,3,4,5)p4. The activity of the inositol 1,4,5-trisphosphate 3-kinase is responsible for regulating the levels of a large number of inositol polyphosphates that are important in cellular signaling. Both calcium/calmodulin and protein phosphorylation mechanisms control its activity. It is also a substrate for the cyclic amp-dependent protein kinase, calcium/calmodulin- dependent protein kinase ii, and protein kinase c in vitro. Itpka and itpkb are 68% identical in the c-terminus region. [Provided by refseqsequence: dgscstdfkttrsreqvlrvfeefvqgdeevlrrylnrlqqirdtlevseffrrhev