Web Analytics
518-831-8000 sales@utechproducts.com

JMJD2A, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant JMJD2A, Each

1,757.70

Details:

This gene is a member of the Jumonji domain 2 (JMJD2) family and encodes a protein containing a JmjN domain, a JmjC domain, a JD2H domain, two TUDOR domains, and two PHD-type zinc fingers. This nuclear protein functions as a trimethylation-specific demethylase, converting specific trimethylated histone residues to the dimethylated form, and as a transcriptional repressor. [provided by RefSeqSequence: DVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFLKESELPPRAGNEEECPEEDMEGVEDGEEGDLKTSLAKHRIGTKRHRVCLEIPQEVSQSELFPKEDLSSEQYEMTEC

Additional Information

SKU 10286722
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20387