Jmjd2a, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Jmjd2a, Each

Details:

This gene is a member of the jumonji domain 2 (jmjd2) family and encodes a protein containing a jmjn domain, a jmjc domain, a jd2h domain, two tudor domains, and two phd-type zinc fingers. This nuclear protein functions as a trimethylation-specific demethylase, converting specific trimethylated histone residues to the dimethylated form, and as a transcriptional repressor. [Provided by refseqsequence: dvfvrkfqperyklwkagkdntvidhtlptpeaaeflkeselppragneeecpeedmegvedgeegdlktslakhrigtkrhrvcleipqevsqselfpkedlsseqyemtec