Web Analytics
518-831-8000 sales@utechproducts.com

Kazald1, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Kazald1, Each

1,757.70

Details

This gene encodes a secreted member of the insulin growth factor-binding protein (igfbp) superfamily. It contains an n-terminal insulin growth factor-binding domain, a central kazal-type serine protease inhibitor and follistatin-like domain, and a c-terminal immunoglobulin-like domain. Studies of the mouse ortholog suggest that this gene product may have a function in bone development and bone regeneration. [Provided by refseqsequence: ifgcevfaypmasiewrkdgldiqlpgddphisvqfrggpqrfevtgwlqiqavrpsdegtyrclarnalgqveapasltvltpdqlnstgipqlrslnlvpe

Additional Information

SKU 10286881
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20562