Web Analytics
518-831-8000 sales@utechproducts.com

KCNG1 Rabbit anti-Human, Mouse, Rat, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant KCNG1, Each

1,757.70

Details:

Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, subfamily G. This gene is abundantly expressed in skeletal muscle. Multiple alternatively spliced transcript variants have been found in normal and cancerous tissues. [provided by RefSeqSequence: MTLLPGDNSDYDYSALSCTSDASFHPAFLPQRQAIKGAFY

Additional Information

SKU 10289466
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23557