Web Analytics
518-831-8000 sales@utechproducts.com

KCNK1, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant KCNK1, Each

1,757.70

Details:

This gene encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. The product of this gene has not been shown to be a functional channel, however, it may require other nonpore-forming proteins for activity. [provided by RefSeqSequence: YVKKDKDEDQVHIIEHDQLSFSSITDQAAGMKEDQKQNEPFVATQSSACVDGPAN

Additional Information

SKU 10287140
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20865