Web Analytics
518-831-8000 sales@utechproducts.com

Kcnk1, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Kcnk1, Each

$ 1,757.70

Details

This gene encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming p domains. The product of this gene has not been shown to be a functional channel, however, it may require other nonpore-forming proteins for activity. [Provided by refseqsequence: yvkkdkdedqvhiiehdqlsfssitdqaagmkedqkqnepfvatqssacvdgpan

Additional Information

SKU 10287140
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20865