Kcnk17, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Kcnk17, Each

Details:

The protein encoded by this gene belongs to the family of potassium channel proteins containing two pore-forming p domains. This channel is an open rectifier which primarily passes outward current under physiological k concentrations. This gene is activated at alkaline ph. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [Provided by refseqsequence: cscchhsskedfksqswrqgpdrepeshspqqgcypegpmgiiqhlepsahaagcgkds