Web Analytics
518-831-8000 sales@utechproducts.com

KIF21B Rabbit anti-Human, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant KIF21B, Each

1,757.70

Details:

KIF21B belongs to a family of plus end-directed kinesin (see MIM 600025) motor proteins. Neurons use kinesin and dynein (see MIM 600112) microtubule-dependent motor proteins to transport essential cellular components along axonal and dendritic microtubules.[supplied by OMIMSequence: RKTQEVSALRRLAKPMSERVAGRAGLKPPMLDSGAEVSASTTSSEAESGARSVSSIVRQWNRKINHFLGDHPAPTVNGTRPARKKFQKKG

Additional Information

SKU 10288146
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22014