Web Analytics
518-831-8000 sales@utechproducts.com

KIF4A Rabbit anti-Human, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant KIF4A, Each

1,757.70

Details:

Kinesins, such as KIF4A, are microtubule-based motor proteins that generate directional movement along microtubules. They are involved in many crucial cellular processes, including cell division (Zhu and Jiang, 2005 [PubMed 15625105]).[supplied by OMIMSequence: LTLLQVASRQKHLPKDTLLSPDSSFEYVPPKPKPSRVKEKFLEQSMDIEDLKYCSEHSVNEHEDGDGDDDEGDDEEWKPTKL

Additional Information

SKU 10288833
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22821