Kirrel, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Kirrel, Each

Details:

Neph1 is a member of the nephrin-like protein family, which includes neph2 (mim 607761) and neph3 (mim 607762). The cytoplasmic domains of these proteins interact with the c terminus of podocin (nphs2; mim 604766), and the genes are expressed in kidney podocytes, cells involved in ensuring size- and charge-selective ultrafiltration (sellin et al., 2003 [Pubmed 12424224]).[Supplied by omimsequence: vtlsiepqtvqegervvftcqatanpeilgyrwakggfliedahesryetnvdysfftepvscevhnkvgstnvstlvnvhfaprivvdpkptttdigsdvtltcvwvgnppltltwtkkdsnmvlsnsnqlllksvtqada