Web Analytics
518-831-8000 sales@utechproducts.com

Kng1 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Kng1, Each

$ 1,757.70

Details

High molecular weight kininogen (hmwk) plays an important role in assembly of the plasma kallikrein (see mim 147910)-kinin system. The kng1 gene generates both hmwk and low molecular weight kininogen (lmwk) through alternative splicing. Both hmwk and lmwk contain an identical heavy chain consisting of protein domains 1, 2, and 3. However, hmwk contains a 56kda light chain that consists of domains 5 and 6h, whereas lmwk contains a unique 4kda light chain that consists of domain 5l. In both proteins, the heavy and light chains are linked by domain 4, which contains the bradykinin (bk) nonapeptide. Bk, which is released by plasma kallikrein, is a potent inflammatory mediator that causes vasodilation and enhanced capillary permeability, induces pain, and stimulates production of nitric oxide and prostacyclin (see mim 601699) from endothelial cells. During vascular damage, bk stimulates smooth muscle proliferation and intimal hypertrophy. Release of bk from hmwk generates a 2-chain hmwk, termed hmwka, containing the heavy and light chains joined by a disulfide bond (merkulov et al., 2008 [Pubmed 18000168]).[Supplied by omimsequence: lfltpdckslwngdtgectdnayidiqlriasfsqncdiypgkdfvqpptkicvgcprdiptnspeleetlthtitklnaennatfyfkidnvkkarvqvvagkkyfidfvarettcskesneeltescetk

Additional Information

SKU 10292352
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB28471