Krt19 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Krt19, Each
|
|
Details:
The protein encoded by this gene is a member of the keratin family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. The type i cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains. Unlike its related family members, this smallest known acidic cytokeratin is not paired with a basic cytokeratin in epithelial cells. It is specifically expressed in the periderm, the transiently superficial layer that envelopes the developing epidermis. The type i cytokeratins are clustered in a region of chromosome 17q12-q21. [Provided by refseqsequence: teelnrevaghteqlqmsrsevtdlrrtlqgleielqsqlsmkaaledtlaetearfgaqlahiqalisgieaqlgdvradserqnqeyqrlmdiksrleqeiatyrsllegqedhynnlsaskvl
Additional Information
| SKU | 10292507 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB28668 |
