Web Analytics
518-831-8000 sales@utechproducts.com

Lace1 Rabbit Anti-Human, Mouse, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Lace1, Each

1,757.70

Details:

This gene encodes a protein with possible atpase function. The protein contains a p-loop motif and a five-domain structure that is conserved in fly, yeast, and bacteria. Two conserved estrogen receptor binding sites are located within 2.5Kb of this gene. [Provided by refseqsequence: nglqranfvpfiavlkeycntvqldsgidyrkrelpaagklyyltseadveavmdklfdelaqkqndlt

Additional Information

SKU 10288468
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22401