Web Analytics
518-831-8000 sales@utechproducts.com

LACTB Rabbit anti-Human, Mouse, Rat, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant LACTB, Each

1,757.70

Details:

This gene encodes a protein from the large 39S subunit of the mitochondrial ribosome (mitoribosome). The encoded protein has some sequence similarity to prokaryotic beta-lactamases but most of the residues that are responsible for the beta-lactamase activity are not conserved between the two proteins. [provided by RefSeqSequence: KEGKSNEKNDFTKFKTEQENEAKCRNSKPGKKKNDFEQGELYLREKFENSIESLRLFKNDPLFFKPGSQFLYSTFGYTLL

Additional Information

SKU 10288973
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22990