Web Analytics
518-831-8000 sales@utechproducts.com

LAPTM4A Rabbit anti-Human, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant LAPTM4A, Each

1,757.70

Details:

This gene encodes a protein that has four predicted transmembrane domains. The function of this gene has not yet been determined; however, studies in the mouse homolog suggest a role in the transport of small molecules across endosomal and lysosomal membranes. [provided by RefSeqSequence: EVTHPNSMPAVNIQYEVIGNYYSSERMADN

Additional Information

SKU 10288795
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22778