Lgals7b Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Lgals7b, Each
$ 1,757.70
|
|
Details:
The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. Differential and in situ hybridization studies indicate that this lectin is specifically expressed in keratinocytes and found mainly in stratified squamous epithelium. A duplicate copy of this gene (geneid:3963) is found adjacent to, but on the opposite strand on chromosome 19. [Provided by refseqsequence: phksslpegirpgtvlrirglvppnasrfhvnllcgeeqgsdaalhfnprldtsevvfnskeqgswgreergpgvpfqrgqpfevliiasddgfkavvgdaqyhhfrhrlplarvrlvevggdvqldsv
Additional Information
| SKU | 10291687 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB27459 |
