Lman1, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Lman1, Each

Details:

The protein encoded by this gene is a type i integral membrane protein localized in the intermediate region between the endoplasmic reticulum and the golgi, presumably recycling between the two compartments. The protein is a mannose-specific lectin and is a member of a novel family of plant lectin homologs in the secretory pathway of animal cells. Mutations in the gene are associated with a coagulation defect. Using positional cloning, the gene was identified as the disease gene leading to combined factor v-factor viii deficiency, a rare, autosomal recessive disorder in which both coagulation factors v and viii are diminished. [Provided by refseqsequence: ignngqihydhqndgasqalascqrdfrnkpypvrakityyqntltvminngftpdkndyefcakvenmiipaqghfgisaatggladdhdvlsfltfqltepgkep