Lonp1, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Lonp1, Each

Details:

This gene encodes a mitochondrial matrix protein in the lon family of atp-dependent proteases. A similar e. Coli protein regulates gene expression by targeting specific regulatory proteins for degradation. This protein binds a specific sequence in the light and heavy chain promoters of the mitochondrial genome which are involved in regulation of dna replication and transcription. [Provided by refseqsequence: veekikqthrkyllqeqlkiikkelglekddkdaieekfrerlkelvvpkhvmdvvdeelsklglldnhssefnvtrnyldwltsipwgkysnenldlaraqavleedhygmedvkkrilefiavsqlrgstqgkilcfygp