Web Analytics
518-831-8000 sales@utechproducts.com

Lrba Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Lrba, Each

1,757.70

Details

Patients with chediak-higashi syndrome (chs1; mim 214500) suffer from a systemic immunodeficiency involving defects in polarized trafficking of vesicles in a number of immune system cell types. In mouse, this syndrome is reproduced in strains with a mutation in the 'beige' gene that results in proteins lacking the beach (beige and chs1) domain and c-terminal wd repeats. Lrba contains key features of both beige/chs1 and a kinase anchor proteins (akaps; see mim 602449).[Supplied by omimsequence: ggwrvwvdtlsithskvtfeihkenlanifreqqgkvdeeiglcsstsvqaasgirrdinvsvgsqqpdtkdspvcphfttngnenssiektsslesasnielqttntsyeemkaeqenqelpdegtleetl

Additional Information

SKU 10287775
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21593