Lrba Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Lrba, Each
$ 1,757.70
|
|
Details:
Patients with chediak-higashi syndrome (chs1; mim 214500) suffer from a systemic immunodeficiency involving defects in polarized trafficking of vesicles in a number of immune system cell types. In mouse, this syndrome is reproduced in strains with a mutation in the 'beige' gene that results in proteins lacking the beach (beige and chs1) domain and c-terminal wd repeats. Lrba contains key features of both beige/chs1 and a kinase anchor proteins (akaps; see mim 602449).[Supplied by omimsequence: ggwrvwvdtlsithskvtfeihkenlanifreqqgkvdeeiglcsstsvqaasgirrdinvsvgsqqpdtkdspvcphfttngnenssiektsslesasnielqttntsyeemkaeqenqelpdegtleetl
Additional Information
| SKU | 10287775 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB21593 |
