Web Analytics
518-831-8000 sales@utechproducts.com

LRCH4 Rabbit anti-Human, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant LRCH4, Each

1,757.70

Details:

This gene encodes a protein that contains leucine-rich repeats (LRR) at its amino terminus and that is known to be involved in ligand binding. The carboxyl terminus may act as a membrane anchor. Identified structural elements suggest that the encoded protein resembles a receptor. [provided by RefSeqSequence: LPIAGPATAPAPRPLGSIQRPNSFLFRSSSQSGSGPSSPDSVLRPRRYPQVPDEKDLMTQLRQVLESRLQ

Additional Information

SKU 10289107
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23147