Web Analytics
518-831-8000 sales@utechproducts.com

LRP12, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant LRP12, Each

1,757.70

Details:

This gene was identified by its differential expression in cancer cells. The product of this gene is predicted to be a transmembrane protein. The level of this protein was found to be lower in tumor derived cell lines compared to normal cells. This gene was thus proposed to be a candidate tumor suppressor gene. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeqSequence: FPVCSPNQASVLENLRLAVRSQLGFTSVRLPMAGRSSNIWNRIFNFARSRHSGSLALVSADGDEVVPSQSTSREPERNHTHRSLFSVESDDTDTENERRDMAGASGGVAAPLPQKVPPTTAVEATVGACASSS

Additional Information

SKU 10287193
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20931