Web Analytics
518-831-8000 sales@utechproducts.com

LSG1, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant LSG1, Each

1,757.70

Details:

This gene encodes a protein related to the yeast large subunit GTPase 1. The encoded protein is necessary for cell viability and may localize in the endoplasmic reticulum, nucleus and cytoplasmSequence: SELNDGYDWGRLNLQSVTEQSSLDDFLATAELAGTEFVAEKLNIKFVPAEARTGLLSFEESQRIKKLHEENKQFLCIPRRPNWNQNTTPEE

Additional Information

SKU 10289111
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23151