Web Analytics
518-831-8000 sales@utechproducts.com

LSM8, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant LSM8, Each

1,757.70

Details:

This gene is a member of the LSm family and encodes a protein with a closed barrel shape, made up of five anti-parallel beta strands and an alpha helix. The protein partners with six paralogs to form a heteroheptameric ring which transiently binds RNAs and is involved in the general maturation of RNA in the nucleus. [provided by RefSeqSequence: ALENYINRTVAVITSDGRMIVGTLKGFDQTINLILDESHERVFSSSQGVEQVVLGLYIVRGDNVAVIGEIDEETDSALDLGNIRAEP

Additional Information

SKU 10287490
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21274