Web Analytics
518-831-8000 sales@utechproducts.com

Lsm8, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Lsm8, Each

1,757.70

Details

This gene is a member of the lsm family and encodes a protein with a closed barrel shape, made up of five anti-parallel beta strands and an alpha helix. The protein partners with six paralogs to form a heteroheptameric ring which transiently binds rnas and is involved in the general maturation of rna in the nucleus. [Provided by refseqsequence: alenyinrtvavitsdgrmivgtlkgfdqtinlildeshervfsssqgveqvvlglyivrgdnvavigeideetdsaldlgniraep

Additional Information

SKU 10287490
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21274