Ly6g5c, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Ly6g5c, Each

Details:

Ly6g5c belongs to a cluster of leukocyte antigen-6 (ly6) genes located in the major histocompatibility complex (mhc) class iii region on chromosome 6. Members of the ly6 superfamily typically contain 70 to 80 amino acids, including 8 to 10 cysteines. Most ly6 proteins are attached to the cell surface by a glycosylphosphatidylinositol (gpi) anchor that is directly involved in signal transduction (mallya et al., 2002 [Pubmed 12079290]).[Supplied by omimsequence: adlpscwgagpcytghkvgalrrdtvicccrhgdystpclftpgkpsrnpspwkrtlwt