Web Analytics
518-831-8000 sales@utechproducts.com

LY6G5C, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant LY6G5C, Each

1,757.70

Details:

LY6G5C belongs to a cluster of leukocyte antigen-6 (LY6) genes located in the major histocompatibility complex (MHC) class III region on chromosome 6. Members of the LY6 superfamily typically contain 70 to 80 amino acids, including 8 to 10 cysteines. Most LY6 proteins are attached to the cell surface by a glycosylphosphatidylinositol (GPI) anchor that is directly involved in signal transduction (Mallya et al., 2002 [PubMed 12079290]).[supplied by OMIMSequence: ADLPSCWGAGPCYTGHKVGALRRDTVICCCRHGDYSTPCLFTPGKPSRNPSPWKRTLWT

Additional Information

SKU 10289263
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23329