Web Analytics
518-831-8000 sales@utechproducts.com

LY6G6F, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant LY6G6F, Each

1,757.70

Details:

The human G6f protein is a type I transmembrane protein belonging to the immunoglobin (Ig) superfamily, which is comprised of cell-surface proteins involved in the immune system and cellular recognition (de Vet et al., 2003 [PubMed 12852788]).[supplied by OMIMSequence: LLGNYSLWLEGSKEEDAGRYWCAVLGQHHNYQNWRVYDVLVLKGSQLSARAADGSPCNVLLCSVVPSRRMDSVTWQEGKGPVRGRVQSFWGSEAALLLVCPGEGLSEPRSRRPRIIRCLMTHNKGVSFSLAASIDASPAL

Additional Information

SKU 10286739
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20407