Web Analytics
518-831-8000 sales@utechproducts.com

Ly6g6f, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Ly6g6f, Each

1,757.70

Details:

The human g6f protein is a type i transmembrane protein belonging to the immunoglobin (ig) superfamily, which is comprised of cell-surface proteins involved in the immune system and cellular recognition (de vet et al., 2003 [Pubmed 12852788]).[Supplied by omimsequence: llgnyslwlegskeedagrywcavlgqhhnyqnwrvydvlvlkgsqlsaraadgspcnvllcsvvpsrrmdsvtwqegkgpvrgrvqsfwgseaalllvcpgeglseprsrrpriirclmthnkgvsfslaasidaspal

Additional Information

SKU 10286739
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20407