Web Analytics
518-831-8000 sales@utechproducts.com

LYZL6, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant LYZL6, Each

1,757.70

Details:

Lysozymes (see LYZ; MIM 153450), especially C-type lysozymes, are well-recognized bacteriolytic factors widely distributed in the animal kingdom and play a mainly protective role in host defense. LYZL6 is a member of a family of lysozyme-like genes (Zhang et al., 2005 [PubMed 16014814]).[supplied by OMIMSequence: CNDYKSYSENLCHVDCQDLLNPNLLAGIHCAKRIVSGARGMNNWVEWRLHCSGRP

Additional Information

SKU 10287947
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21780