Web Analytics
518-831-8000 sales@utechproducts.com

Mad1l1 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Mad1l1, Each

$ 1,757.70

Details

Mad1l1 is a component of the mitotic spindle-assembly checkpoint that prevents the onset of anaphase until all chromosome are properly aligned at the metaphase plate. Mad1l1 functions as a homodimer and interacts with mad2l1. Mad1l1 may play a role in cell cycle control and tumor suppression. Three transcript variants encoding the same protein have been found for this gene. [Provided by refseqsequence: tkvlhmslnptsvarqrlredhsqlqaecerlrgllramerggtvpadleaaaaslpsskevaelkkqvesaelknqrlkevfqtkiqefrkacytltgyqidittenqyrltslyaehpgdclifkatspsgskmqlleirrapplsnn

Additional Information

SKU 10286593
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20232