Web Analytics
518-831-8000 sales@utechproducts.com

MAFB, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant MAFB, Each

1,773.90

Details:

The protein encoded by this gene is a basic leucine zipper (bZIP) transcription factor that plays an important role in the regulation of lineage-specific hematopoiesis. The encoded nuclear protein represses ETS1-mediated transcription of erythroid-specific genes in myeloid cells. This gene contains no introns. [provided by RefSeqSequence: MEYVNDFDLLKFDVKKEPLGRAERPGRPCTRLQPAGSVSSTPLSTPCSSVPSSPSFSPTEQKTHLEDLYWMASNYQQMNPEALNLTPEDAVEALIGSHPVPQPLQSFDSFRGAHHHHHHHHPH

Additional Information

SKU 10286655
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20308