Web Analytics
518-831-8000 sales@utechproducts.com

MAP1B, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant MAP1B, Each

1,757.70

Details:

This gene encodes a protein that belongs to the microtubule-associated protein family. The proteins of this family are thought to be involved in microtubule assembly, which is an essential step in neurogenesis. The product of this gene is a precursor polypeptide that presumably undergoes proteolytic processing to generate the final MAP1B heavy chain and LC1 light chain. Gene knockout studies of the mouse microtubule-associated protein 1B gene suggested an important role in development and function of the nervous system. [provided by RefSeqSequence: EVVEEHCASPEDKTLEVVSPSQSVTGSAGHTPYYQSPTDEKSSHLPTEVIEKPPAVPVSFEFSDAKDENERASVSPMDEPVPDSESPIEKVLSPLRSPPLIGSESAYESFLSADDKASGRGAESPFEEKSGKQGSPDQVSPVSEMTST

Additional Information

SKU 10287678
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21488