Web Analytics
518-831-8000 sales@utechproducts.com

Map3k7ip3 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Map3k7ip3, Each

$ 1,757.70

Details

The product of this gene functions in the nf-kappab signal transduction pathway. The encoded protein, and the similar and functionally redundant protein map3k7ip2/tab2, forms a ternary complex with the protein kinase map3k7/tak1 and either traf2 or traf6 in response to stimulation with the pro-inflammatory cytokines tnf or il-1. Subsequent map3k7/tak1 kinase activity triggers a signaling cascade leading to activation of the nf-kappab transcription factor. The human genome contains a related pseudogene. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [Provided by refseqsequence: qpkppfsvnpvyitytqptgpsctpspsprvipnpttvfkitvgrattenllnlvdqeersaapepiqpisvipgsggekgshkyqrssssgsddya

Additional Information

SKU 10288750
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22722