Web Analytics
518-831-8000 sales@utechproducts.com

MAP6D1, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant MAP6D1, Each

1,757.70

Details:

This gene encodes a protein highly similar to the mouse MAP6 domain containing 1 protein, which is related to the STOP proteins. Based on the study of the mouse protein, the encoded protein may function as a calmodulin-regulated neuronal protein that binds and stabilizes microtubules but also associates with the Golgi membranes through N-terminal palmitoylation. [provided by RefSeqSequence: GKSSAQSSAPPAPGARGVYVLPIGDADAAAAVTTSYRQEFQAWTGVKPSRSTKTKPARVITTHTSGWDSSPGAGFQVPEVRKKFTPNPSAIFQASAP

Additional Information

SKU 10289154
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23199