Web Analytics
518-831-8000 sales@utechproducts.com

Map6d1, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Map6d1, Each

$ 1,757.70

Details

This gene encodes a protein highly similar to the mouse map6 domain containing 1 protein, which is related to the stop proteins. Based on the study of the mouse protein, the encoded protein may function as a calmodulin-regulated neuronal protein that binds and stabilizes microtubules but also associates with the golgi membranes through n-terminal palmitoylation. [Provided by refseqsequence: gkssaqssappapgargvyvlpigdadaaaavttsyrqefqawtgvkpsrstktkparvitthtsgwdsspgagfqvpevrkkftpnpsaifqasap

Additional Information

SKU 10289154
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23199