Map6d1, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Map6d1, Each

Details:

This gene encodes a protein highly similar to the mouse map6 domain containing 1 protein, which is related to the stop proteins. Based on the study of the mouse protein, the encoded protein may function as a calmodulin-regulated neuronal protein that binds and stabilizes microtubules but also associates with the golgi membranes through n-terminal palmitoylation. [Provided by refseqsequence: gkssaqssappapgargvyvlpigdadaaaavttsyrqefqawtgvkpsrstktkparvitthtsgwdsspgagfqvpevrkkftpnpsaifqasap