Web Analytics
518-831-8000 sales@utechproducts.com

MASP1, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant MASP1, Each

1,757.70

Details:

The Ra-reactive factor (RARF) is a complement-dependent bactericidal factor that binds to the Ra and R2 polysaccharides expressed by certain enterobacteria. Alternate splicing of this gene results in multiple transcript variants encoding two RARF components that are involved in the mannan-binding lectin (MBL) pathway of complement activation. Two of the isoforms are cleaved into two chains which form a heterodimer linked by a disulfide bond. The encoded proteins are members of the trypsin family of peptidases. [provided by RefSeqSequence: PCPYDYIKIKVGPKVLGPFCGEKAPEPISTQSHSVLILFHSDNSGENRGWRLSYRAAGNECPELQPPVHGKIEPSQAKYFFKDQVLVSCDTGYKVLKDNVEMDTFQIECLKDGTWSNKIPT

Additional Information

SKU 10292344
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB28463