Web Analytics
518-831-8000 sales@utechproducts.com

MATR3 Rabbit anti-Human, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant MATR3, Each

1,757.70

Details:

The protein encoded by this gene is localized in the nuclear matrix. It may play a role in transcription or may interact with other nuclear matrix proteins to form the internal fibrogranular network. Two transcript variants encoding the same protein have been identified for this gene. [provided by RefSeqSequence: LKRRRTEEGPTLSYGRDGRSATREPPYRVPRDDWEEKRHFRRDSFDDRGPSLNPVLDYDHGSRSQESGYYDRMDYEDDRLRDGERCRDD

Additional Information

SKU 10289005
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23027